ACTN4 (Human) Recombinant Protein (Q01)
| Specification | |
|---|---|
| Product Description | Human ACTN4 partial ORF ( NP_004915, 592 a.a. - 701 a.a.) recombinant protein with GST-tag at N-terminal. |
| Catalog # | PTG-H00000081-Q01-25 |
| Sell Price | 543.00 € |
| Size | 25 ug |
| Immunogen Sequence | KEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLR RQFASQANVVGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYK |
| Type clonality | Protein |
| Application key | AP,WB-Re,ELISA,Array |
| Gene Alias | ACTININ-4|DKFZp686K23158|FSGS|FSGS1 |
| Gene Description | actinin, alpha 4 |
| Genbank Accession | NM_004924 |
| Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 |
| Storage Instruction | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Note | Best use within three months from the date of receipt of this protein. |
| Brand Name | Proteogenix |
