ACSS2 (Human) Recombinant Protein (Q01)
| Specification | |
|---|---|
| Product Description | Human ACSS2 partial ORF ( NP_061147.1, 32 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal. |
| Catalog # | PTG-H00055902-Q01-25 |
| Sell Price | 543.00 € |
| Size | 25 ug |
| Immunogen Sequence | PPEVSRSAHVPSLQRYRELHRRSVEEPREFWGDIAKEFYWKTPCPGPFLRYNFDVTKGKI FIEWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEP |
| Type clonality | Protein |
| Application key | WB-Re,ELISA,Array,AP |
| Gene Alias | ACAS2|ACS|ACSA|AceCS|DKFZp762G026|dJ1161H23.1 |
| Gene Description | acyl-CoA synthetase short-chain family member 2 |
| Genbank Accession | NM_018677 |
| Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 |
| Storage Instruction | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Note | Best use within three months from the date of receipt of this protein. |
| Brand Name | Proteogenix |
