ACAT2 (Human) Recombinant Protein (Q01)
| Specification | |
|---|---|
| Product Description | Human ACAT2 partial ORF ( NP_005882, 104 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal. |
| Catalog # | PTG-H00000039-Q01-25 |
| Sell Price | 543.00 € |
| Size | 25 ug |
| Immunogen Sequence | QSIGIGDSSIVVAGGMENMSKAPHLAYLRTGVKIGEMPLTDSILCDGLTDAFHNCHMGIT AENVATKWQVSREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGL |
| Type clonality | Protein |
| Application key | AP,WB-Re,ELISA,Array |
| Gene Alias | - |
| Gene Description | acetyl-Coenzyme A acetyltransferase 2 |
| Genbank Accession | NM_005891 |
| Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 |
| Storage Instruction | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Note | Best use within three months from the date of receipt of this protein. |
| Brand Name | Proteogenix |
