| Specification |
|
| Product Description |
Human ABI1 partial ORF ( NP_001012770, 185 a.a. - 238 a.a.) recombinant protein with GST-tag at N-terminal. |
| Catalog # |
PTG-H00010006-Q01-25 |
| Sell Price |
543.00 € |
| Size |
25 ug |
| Immunogen Sequence |
GTLGRNTPYKTLEPVKPPTVPNDYMTSPARLGSQHSPGRTASLNQRPRTHSGSS
|
| Type clonality |
Protein |
| Application key |
AP,WB-Re,Array,ELISA |
| Gene Alias |
ABI-1|E3B1|NAP1BP|SSH3BP|SSH3BP1 |
| Gene Description |
abl-interactor 1 |
| Genbank Accession |
NM_001012752 |
| Storage Buffer |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 |
| Storage Instruction |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Note |
Best use within three months from the date of receipt of this protein. |
| Brand Name |
Proteogenix |